Pay in 4 interest-free payments of $53.12 Learn more
Ships within 48 hours · Estimated delivery Jul 27 - Aug 1
Septin 7 (M368) Polyclonal Antibody
RRID: AB_2840268
Alternative Name: PPP2R5A
SAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSD
LIN28B Monoclonal Antibody
JAK2 Polyclonal Antibody-BS90750 Size:100µl Septin 7 (M368) Polyclonal AntibodyJAK2 Polyclonal Antibody Sizes: 50l, 100l Catalogue Numbers: BS90750 50, BS90750 100 Product: Rabbit IgG, 1mg ml in PBS with 0. 02% sodium azide, 50% glycerol, pH7. 2 Swiss Prot: O60674(Human) Q62120(Mouse) Q62689(Rat) Host: Rabbit Reactivity: Human, Mouse, Rat Applications: ICC IHC All Applications: ICC: 1: 50 1: 200 IHC: 1: 50 1: 200 Background: JAK2 (Janus kinase 2) belongs to the emerging family of non receptor Janus tyrosine kinases, which